PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0326s0320.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 567aa    MW: 63205.3 Da    PI: 4.934
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0326s0320.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.53.9e-51121382128
                     NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                             p GfrF+P+deelv++yL+ k++g++  + +vi+e+d++k+ePwdLp  + +k++++ew+fF++ d+k+++g+r nrat++gyWkat
  SapurV1A.0326s0320.1.p  12 PLGFRFRPSDEELVDYYLRLKINGDDDGV-KVIPEIDVCKWEPWDLPdfSIIKSKDSEWFFFCPVDRKHPNGSRLNRATNAGYWKAT 97 
                             89************************888.99***************6447888999****************************** PP

                     NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             g+d++++s +++l+g+kktLvfy+grapkg++t+Wvmheyr+
  SapurV1A.0326s0320.1.p  98 GTDRKIKS-GNNLIGMKKTLVFYRGRAPKGKRTHWVMHEYRA 138
                             ********.999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-584161IPR003441NAC domain
PROSITE profilePS5100554.56111161IPR003441NAC domain
PfamPF023652.6E-2612137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002230Biological Processpositive regulation of defense response to virus by host
GO:0002237Biological Processresponse to molecule of bacterial origin
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MAVFSLNFNS FPLGFRFRPS DEELVDYYLR LKINGDDDGV KVIPEIDVCK WEPWDLPDFS  60
IIKSKDSEWF FFCPVDRKHP NGSRLNRATN AGYWKATGTD RKIKSGNNLI GMKKTLVFYR  120
GRAPKGKRTH WVMHEYRATE EELDGTKPGQ SPFVLSRLFK KQDESIESLS RDEAEATISS  180
PTMVQSSLEV TQSNQPLIEA SPANTTSEVV APVEPQSNNF GVCEGGDQFV DPGASEGDIP  240
QEEALNRFID SPPESRYYKI FSPLHVQVQS AMGSSSMFYP SNNELSTSIE GLQFHYGANE  300
TYANPSDFID SMTAELSYGE SSVQNNSTIP HESLESVVFV KDSGSYSGSD VDLASIRIQQ  360
EFHGTVLPEE LYEQRSLLAI SASDQFNNLN KGSNNTNQVG GSDIGWGGVR IRPRNPQNQR  420
FDRNTNTQGD ASRRLLLQNK LQVHFNTKSG DLSSEEVESE CIVTKEAKIT EMENTVCGGD  480
TSAIDEQHRR SLIEASESLK FSEVMHNNGI DMKNNCSILS KVSPLFSKAS RARNPIWATT  540
MFWAAVLAVL FAVLVNRWGH FILNTA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-451016516169NO APICAL MERISTEM PROTEIN
1ut4_B9e-451016516169NO APICAL MERISTEM PROTEIN
1ut7_A9e-451016516169NO APICAL MERISTEM PROTEIN
1ut7_B9e-451016516169NO APICAL MERISTEM PROTEIN
3swm_A1e-441016219169NAC domain-containing protein 19
3swm_B1e-441016219169NAC domain-containing protein 19
3swm_C1e-441016219169NAC domain-containing protein 19
3swm_D1e-441016219169NAC domain-containing protein 19
3swp_A1e-441016219169NAC domain-containing protein 19
3swp_B1e-441016219169NAC domain-containing protein 19
3swp_C1e-441016219169NAC domain-containing protein 19
3swp_D1e-441016219169NAC domain-containing protein 19
4dul_A9e-451016516169NAC domain-containing protein 19
4dul_B9e-451016516169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321956.20.0hypothetical protein POPTR_0015s00640g
TrEMBLB9IDH00.0B9IDH0_POPTR; Uncharacterized protein
STRINGPOPTR_0015s00640.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55513353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.25e-99TCV-interacting protein